PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DS_FE10585EC.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 366aa    MW: 37594.8 Da    PI: 8.2289
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DS_FE10585EC.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.92e-3793152261
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                            +e+ lkcprCds+ntkfCy+nnyslsqPr+fC+aCrryWt+GGalrnvPvGgg r++ k+
  Traes_1DS_FE10585EC.2  93 PEQGLKCPRCDSANTKFCYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 152
                            57899*************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3777151IPR003851Zinc finger, Dof-type
PfamPF027016.9E-3295151IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.67797151IPR003851Zinc finger, Dof-type
PROSITE patternPS01361099135IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MIFPPSFLDS SSWNDNQLDF EQHAHHQQVA AASCGGGAGD GGCNNHELLQ PSIMQQGTLA  60
EGGDGGGGGG QVVGPAKPMS MSERARLARV PLPEQGLKCP RCDSANTKFC YFNNYSLSQP  120
RHFCRACRRY WTRGGALRNV PVGGGYRRHA KRAKPKQAAA AAAAGAPAAN GAASGGSTTS  180
STTSACTTVS NPAPVLPAML QNGGGGNLSG LLPPLLRLAD FDAMSLGSTF SGMGKPSPVD  240
SAAGYYLGGG GGGAVAGLEQ WRVQQMQGFP FFQAMADQQH TLAPAAAPAM AMPGMFHYLG  300
LGNGGDGRGG HEDDGGDQQF HHAMPSKREG YPRSGSIAMY GGDHHLAAGA GYTSSYSNAA  360
TGNHLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM0843530.0AM084353.1 Hordeum vulgare subsp. vulgare dof5 gene for dof zinc finger protein 5, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638255.11e-107PREDICTED: dof zinc finger protein DOF3.6
TrEMBLW5ANU40.0W5ANU4_WHEAT; Uncharacterized protein
STRINGLOC_Os05g02150.11e-106(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-40OBF-binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]